DexShell @dexshelluk
ELEMENT REPELLENT Socks, hats and gloves. 100% Waterproof, Windproof, Mudproof, Sandproof & Dustproof. Slash Resistant, Thermal & Highly Breathable dexshell.co.uk Manchester Joined April 2013-
Tweets1K
-
Followers982
-
Following668
-
Likes228
Thinking about buying Compression Mudder Socks GREY L? Read the latest review by SimonRoser. via @Yotpo
0
0
0
0
0
Thinking about buying DEXSHELL ULTRA THIN BAMBOO SOCK RED-NAVY L? Read the latest review by DeborahCotterell. via @Yotpo
Thinking about buying DEXSHELL BEANIE SOLO L/XL? Read the latest review by GrahamWaites. via @Yotpo
Thinking about buying DEXSHELL ULTRA DRI SPORTS SOCK S? Read the latest review by SafijaJusupovic. via @Yotpo
Thinking about buying DEXSHELL THERMFIT NEO GLOVES S? Read the latest review by PollyMair. via @Yotpo
Thinking about buying DEXSHELL ULTRA THIN CHILDREN'S SOCKS? Read the latest review by MeganBingley. via @Yotpo
Thinking about buying Compression Mudder Socks? Read the latest review by Sarah W. via @Yotpo
Thinking about buying DEXSHELL RUNNING SOCKS BLUE M? Read the latest review by Lesley Y. via @Yotpo
Thinking about buying DEXSHELL ULTRA THIN CHILDREN'S SOCKS NAVY-LIME L? Read the latest review by GRAHAM R. via @Yotpo
Thinking about buying DEXSHELL ULTRA THIN CHILDREN'S SOCKS? Read the latest review by JoelWilcox. via @Yotpo
Thinking about buying ULTRA THIN SOCKS BLACK M? Read the latest review by AngelaO'Neill. via @Yotpo
Thinking about buying DEXSHELL ULTRA THIN CREW SOCKS NAVY-LIME S? Read the latest review by MarionNormand. via @Yotpo
Thinking about buying ULTRA THIN SOCKS GREY L? Read the latest review by Amanda C. via @Yotpo
Thinking about buying ULTRA THIN SOCKS GREY L? Read the latest review by ScottHall. via @Yotpo
Thinking about buying THERMFIT GLOVES L? Read the latest review by Jan B. via @Yotpo
Thinking about buying DEXSHELL RUNNING SOCKS BLUE M? Read the latest review by Hazel B. via @Yotpo
Thinking about buying DEXSHELL WINDPROOF SKULL CAP BLACK ONE SIZE? Read the latest review by StephenBolt. via @Yotpo
Thinking about buying CUFFED BEANIE L? Read the latest review by SethOrmsby. via @Yotpo
Thinking about buying DEXSHELL ULTRA THIN CHILDREN'S SOCKS? Read the latest review by MoragYule. via @Yotpo
Thinking about buying DEXSHELL ULTRA DRI SPORTS SOCK L? Read the latest review by PhilipBolton. via @Yotpo
Outdoor Action Ltd @outdooraction_
2K Followers 65 Following Family-run with over 50 years in the outdoor and leisure industry ⛺️ 👉https://t.co/O6kZ5c2nNi
Senator Parting @s_parting
240 Followers 2K Following
RachelOnTheRun🏃�... @Rachel_Mellor_
193 Followers 576 Following Mummy 💞, Runner 🏃🏻♀️, Cake Addict 🍰
Andy @Andy57493803
87 Followers 1K Following
Simon Harwood @simonjharwood
677 Followers 3K Following Blackburn @Rovers fan in exile in Yorkshire. Runner and part time wannabe surfer. @Giants and @Yankees fan
Dean Brown @yorkshireninja
73 Followers 324 Following Gonna eat your brains 🧠 and gain your knowledge
Ian Hall @Parrog3
663 Followers 3K Following Lover of good beer, food, rugby (especially Welsh), and the outdoors 🏴🌳🍻. Heart is in Pembrokeshire.
Upgrade Bikes @UpgradeBikes
2K Followers 572 Following Sussex based distributor of leading cycling brands including Lezyne, Stans, ABUS, Lizard Skins, Praxis, Reynolds Cycling, Challenge Tires, Kinesis & DMR
Pete McNaughton @Pete_Mac_Brum
50 Followers 302 Following Always looking for an adventure, often in, around or under the vast county of Northumberland. Check out my YouTube channel. https://t.co/DQVCLKr3Qe
Jeronimo @JeronimoSDM
407 Followers 2K Following Mi mayor desafío son mis hijos. Biólogo, apasionado de la ciencia y la naturaleza. Corredor .@RetoDravet #montaña #nutrición
Arthur @arthursdug
1K Followers 4K Following Musicrunningdugswalkingvegancyclinggymchesspoliticsmountainsbeercarslaurelnhardysnowboardingmorerunningthe smoutgardeningmorerunningradiopresenter
Stuart Hatcher @SHatcherLegal
1K Followers 2K Following Corporate lawyer, Partner at Forsters LLP, works with #privatebusiness and #familybusiness, Bees United Chair, enthusiastic amateur runner
ULTRA magazine @TheUltraMag
4K Followers 476 Following The UK’s first printed magazine centred on #ultrarunning. Celebrating #ultrarunners, friends, families, volunteers and #ultramarathon race organisers.
WelshManWalking.co.uk... @welshmanwalk
669 Followers 889 Following Hiker, Mountaineer & Discount Travel Expert. I create routes & give them away on my website for FREE. Check me out!
zhengboleiiii @zhengboleiiii
1 Followers 5 Following
tony dodsworth @lordlucan11
251 Followers 1K Following dragon ride 16,17,18,19,21,22 Newcastle-London 24hr finisher, NFFC vz #LCHF endurance cycling and audaxing #yes2meat
Sukhvir Kang @LEADERSSK
28 Followers 1K Following
Staff Howson @StaffHowson
72 Followers 1K Following
Andrew Robinson @AndrewR33212067
97 Followers 2K Following Buy and sell memorabilia, serial comper, footie fanatic, not very good gamer.
Neil @brownhill76
813 Followers 2K Following Retired lacrosse player, poor golfer, football, running, food, MCFC, outdoors🥍 🏌️♂️⚽️ 🏃♂️ 🇬🇧 🏴
susanna nelson @suenelson172
118 Followers 1K Following
Андрій******* @dzembronja
1K Followers 1K Following
The Kit Zone @TheKitZone
75 Followers 576 Following Providing you with with high performance equipment, tactical and sports clothing, high protein and energy health foods.
outdoorinsight @outdoorsightuk
1K Followers 2K Following Fresh News and Stories, Everything Outdoors
FM Textile-Socks Uni @FMTextile
271 Followers 2K Following Socks manufacturer from Pakistan & export to it's valued clients around the globe.
Luke B @lb_outside
13 Followers 705 Following Any excuse to get outside 🏞️ 2022 Goals - Brecon 30 mile challenge hike 👍 Cotswold Way 100km ultra 👍 & Bristol Half Marathon ⏳ 📷 IG: lb.outside
🌻Angela reeve 🍃... @angelareeve952
378 Followers 1K Following #NatureInMyBackYard Nature. Wildlife. Greenspaces. Science. Equality. Clean air for all.💚 #SaveOurGaywood
Steve Bird 🏴�... @blindbirdman
330 Followers 3K Following I am blind due to diabetic retinopathy. Married to Glenys. F1, LH44 fan.I like sport, listening to news, tv, and the radio. I also like a wee dram, too.😉
Davey Catface @moontanboy
174 Followers 570 Following Occasionally make noises,take the odd pic or two, like a walk, like birds and beasts. My noises - https://t.co/E2uTfYGFIQ
Phil S. 'Nature IS Me... @A_Guy_on_here_2
208 Followers 304 Following Mostly Birds but also Sights & Scenes from the Natural World. Moved to Ireland April '22 ☘ Kernow lover.😍 (Banner:A Huttly) Other stuff in my Alt Acc't
harry @ohmbarnacle
84 Followers 3K Following
Karen McGrath @karmcgrath
219 Followers 972 Following
Pierre Valker @petethebikeman
285 Followers 1K Following Proper Cyclist, European, Beer lover & cheese expert who drinks tea at https://t.co/UZnafkn55c
Keswick Mountain Fest... @KeswickFestival
13K Followers 4K Following The UK's #1 Mountain Festival - 16-18 May 2025 Hike, Run, Bike, Swim, Triathlon, Adventure Live Music | Speakers | Activities | Stalls | Street Food | Party
ben wallis @BenEtosha1
1K Followers 3K Following TV producer / director. #borninchina, a #disneynature film. Also #ghostofthemountains and #expedition china. #AgeOfNature for PBS/BBC. Currently @Disney
Gavin @12gavin
100 Followers 139 Following
Martin Steele @shuwarriors2
36 Followers 1K Following
Helen Maric @HelenMaric
246 Followers 5K Following
Pádraigín Ní Dorc... @td_oak
660 Followers 3K Following Research Associate @HealthSciYork I PhD Researcher @UniofStaffs I Natural Environments & Health I Health Inequalities I Participatory Research I Views own.
Simon Guilfoyle @SimonJGuilfoyle
7K Followers 5K Following I carry heavy loads around the hills, drink beer and complain about numerical targets. #intelligentpolicing #COPS30Miler
UKHillwalking @ukhillwalking
13K Followers 697 Following https://t.co/RLxLtcl9st is the fastest growing hillwalking website in the world.
Andi White 🌈 @AndrewRWhite
10K Followers 5K Following Writer & producer of @WalkerMysteries #sapphic books & audios; Presenter of TV series @WalksBritain; Dad, Dog Walker & Yorkshirem'n. ADHD, Trans 🏳️⚧️ 🩷💛💙
GlastoWatch @GlastoWatch
80K Followers 2K Following Glastonbury Festival news, rumours and line-up info. This account is not affiliated to Glastonbury Festival.
Wahoo SYSTM @wahooSYSTM
18K Followers 2K Following We've moved! Please follow @wahoofitness to keep up with all the ways you can train, ride, and connect with your Wahoo X subscription.
Shrewsbury Half Marat... @Shrewsburyhalf
3K Followers 2K Following The Pareto FM Shrewsbury Half Marathon | Shrewsbury Metric Half Marathon | 28.09.25 | Beautiful Town Centre Routes
Fitness Rewards @FitnessRewards1
9K Followers 10K Following
Spokes Fit @spokesfit
19K Followers 9K Following Spokes offers a new & dynamic approach to personalised endurance sports coaching, training & nutrition for athletes of all levels, age & ability.
Giro d'Italia @giroditalia
792K Followers 1K Following Amore Infinito 💞 🏆 2025 Simon Yates #GirodItalia
Mountain Walks @mountainwalksuk
12K Followers 8K Following Guided walks, skills courses and hillwalking events in the Lake District and Snowdonia.
Adie Turford @AdieTurford
893 Followers 3K Following runner. dad. hubby. freelance photographer. lufc fan. old indie music fan. and finally 52
Phil Dransfield @PhilDransfield
231 Followers 486 Following Big Castleford fan, would ski, run and mountain bike for a living if I could 😎
•▪■■○☆Fio... @FionaWupwoo
2K Followers 4K Following Business Director, Artist, Proud mum of 3 amazing boys, wife of a mad entrepreneur, crazy actress presenter of ultimatebrains http://Ourchannel.ultimatebrains.
jodi hill💛 @jodihill01
5K Followers 5K Following Nintendo fan, love to laugh, I’m cheeky and mischievous! love wine! Insta- https://t.co/jlD6VwuT4F https://t.co/GYKLwo7BKJ vibe
Jeff @UKRunCat
4K Followers 1K Following Unprofessional ultra runner, once a completer not competer now DNF doyen. Lover of mountain trails & wilderness. Motorcyclist & director @AscendRuns.
David G. Paul @jedi58
2K Followers 303 Following Lead Engineer (Support) @jadu. Enjoys photography & travel (visited all 7 continents). Painter of miniatures. Ultra & Marathon runner. A756772.
Matt Upston @MattUpston
3K Followers 3K Following Primary PE Consultant. Runner, Triathlete, Cyclist. Host of @UKTriChat. LIRF coach. All views my own.
Dr Nicola Jennings �... @JenningsNicola
2K Followers 2K Following Lboro Uni Pharmaceutical Science. Foundation Programmes Leader. Married. I run. Stokie in Leicester
scott shiels @toonman35
100 Followers 411 Following
theparkrunshow @theparkrunshow
4K Followers 7 Following A digestible audio roundup of everything that caught our eye from the weekend in parkrunworld.
UCI MTB @UCI_MTB
109K Followers 153 Following 🌍 Official account of @UCI_cycling Mountain Bike 📱 #MountainBike #MTBWorldCup
parkrun 🌳 @parkrun
77K Followers 24 Following parkrun is a free, weekly, 5k and 2k community event in open spaces around the world. 🌳 #loveparkrun
parkrun UK @parkrunUK
120K Followers 587 Following with @Vitality_UK. parkrun is a free, weekly, 5k and 2k community event in open spaces around the world. 🌳 #loveparkrun
The Race @TheRace_ie
1K Followers 445 Following 250KM. 24HRS. RUN, CYCLE, KAYAK. IRELAND'S ULTIMATE ENDURANCE EVENT
OMM @theomm
7K Followers 780 Following Specialists in running packs, waterproofs & equipment. Designed for the Iconic Original Mountain Marathon race. #OMM
Bryan Craig @ecfcoach
25K Followers 785 Following ex international swim coach living happy life with my kids learning everyday
UKSportsChat @_UKSportsChat
1K Followers 1K Following Digital Marketing Services for sports & outdoor. Home of @UKRunChat | @UKTriChat | @UKCycleChat | @UKMTB_Chat | Social Media Management | SEO | Digital Strategy
Visit Brecon Beacons ... @VisitBeacons
8K Followers 5K Following Official account for the #BreconBeacons🏴#BannauBrycheiniog news, events & photos. Welsh account @croesoBannau Sign up to our newsletter below⬇️
ENDURO Magazine @enduro_mtb_mag
15K Followers 607 Following Enduro. The most exciting mountainbike magazine of all time. Digital & for free. Read it now!
Broken Riders @brokenriders
5K Followers 2K Following Quality, ethically sourced apparel for anyone who rides mountain bikes. Ride it, stack it, get back on it.
WHOOP UCI Mountain Bi... @MTBworldseries
33K Followers 598 Following Welcome to the official page for the WHOOP UCI Mountain Bike World Series
Specialized UK @Specialized_UK
8K Followers 243 Following We think, talk, love, live and breathe bikes. https://t.co/3wE3W1Lggx
Cotswold Stirling @CotswoldStirlng
222 Followers 260 Following
CYCLE-TRADE @CYCLE_TRADE
643 Followers 731 Following The aim of CYCLE-TRADE is to become the UK’s leading, monthly trade magazine serving the entire bicycle industry!
Expedition&Adventure @Exped_Adventure
1K Followers 4K Following For lovers of all things natural, outdoors and adventurous
DofE Sheffield @DofeSheffield
2K Followers 4K Following The Duke of Edinburgh's Award - Sheffield - developing young people's skills for life and work.
Peloton Proven Bikes @PelotonProven
356 Followers 2K Following dealer in high end, new and certified pre-owned and demo road, triathlon, and mountain bikes and other cycling related gear! Trade-in, Trade-up, and upgrade!
Live For The Hills @liveforthehills
34K Followers 37K Following We offer luxury, private tours of the Peak District National Park. See our unique range of photography tours, scenic tours, Pride & Prejudice tours & lots more
Clare @ThinkingClarely
1K Followers 621 Following Runner of things. Collector of shiny. ⠀⠀⠀⠀⠀⠀⠀⠀ In it for the long run 👊
Stumps Cranks @StumpsCranks
1K Followers 5K Following A book for amputees who want to discover the joys of cycling.
Christine Jenkins �... @gilesyc13
724 Followers 255 Following Retired primary PE teacher, Sports Science HND, Record Breaker 120 WOMEN, 40 BIKES, 1 HOUR #OURHOUR and 🇬🇧 GB Age-Group Triathlete 🇬🇧
peter hollins @hollos49
267 Followers 301 Following Founder of Compagnons Cycling Collective, bespoke cycling tours and training camps. AG world champ duathlete 2014 and world champs silver at triathlon 2019
Emmy @emmyloolah
369 Followers 1K Following Founder of the wondrous Velo Vixens Dubai, 1200+ incredible women cyclists. After 15 years living in UAE, I'm now loving the gravel life in Begur, Catalunya
Macca @Hepworthidle
191 Followers 500 Following Keen Runner, play Cricket for Hepworth & Idle Cricket Club Mountain & Road Biker, member of Otley Cycle Club
Team ActiveAid @ActiveAidUK
522 Followers 730 Following Passionate about Running? Trying to get fit? Like to compete? If so you sound like one of the ActiveAid family! Sign up from May 1st and join the competition...
Cycle New Forest @cyclenewforest
1K Followers 609 Following Inspiring you to get on your bike and make the most of what the New Forest has to offer with routes and maps. https://t.co/APyRTfebx9
Team TotalEnergies @TeamTotalEnrg
111K Followers 455 Following Compte officiel du Team TotalEnergies 🚴♂️ #AllezTotalEnergies ⚡️Trends for United States
19,2 B posts
32,2 B posts
25,7 B posts
18,5 B posts
9.286 posts
1.803 posts
1.219 posts
32,8 B posts
166 B posts
139 B posts
37,1 B posts
41,9 B posts
55,3 B posts
56,1 B posts
64,2 B posts
19,1 B posts
17,7 B posts
681 B posts
You might like
Elon Musk
@elonmusk
227.2M Followers
Barack Obama
@BarackObama
130.1M Followers
Cristiano Ronaldo
@Cristiano
115.2M Followers
Donald J. Trump
@realDonaldTrump
109.6M Followers
Justin Bieber
@justinbieber
107.8M Followers
Rihanna
@rihanna
106.9M Followers
Taylor Swift
@taylorswift13
93.0M Followers
NASA
@NASA
88.1M Followers
Lady Gaga
@ladygaga
81.0M Followers
YouTube
@YouTube
78.4M Followers
Kim Kardashian
@KimKardashian
74.0M Followers
The Ellen Show
@EllenDeGeneres
73.2M Followers
X
@X
68.4M Followers
Virat Kohli
@imVkohli
67.8M Followers
Bill Gates
@BillGates
66.3M Followers
Selena Gomez
@selenagomez
64.5M Followers
CNN Breaking News
@cnnbrk
63.6M Followers
CNN
@CNN
63.6M Followers
Neymar Jr
@neymarjr
63.5M Followers
PMO India
@PMOIndia
59.1M Followers