Twilight Sequence @twilightseq
Modular synths and trees. linktr.ee/twiseq Deep in a woody vale Joined March 2014-
Tweets345
-
Followers1K
-
Following606
-
Likes877
It’s really nice getting back to playing guitar, improvising and loosely putting ideas together for a live set.
0
0
1
40
0
Download Video
We had a visitor to the campfire 😬
New release today! We’ve collaborated with our friend Zeke Clough on a comic book with specially written soundtrack. It looks stunning, Zeke’s ability to create worlds in his mind and then illustrate them beautifully for us all to see is incredible to me: …oughtwilightsequence-cis.bandcamp.com/album/protomur…
Twilight Sequence retweeted
PREORDER: 'Proto Murk' by Zeke Clough Sci-fi graphic novel from the artist behind sleeves for labels including Skull Disco, Planet Mu, Ninja Tune, and Warp. Includes an accompanying Twilight Sequence soundtrack CD. @twilightseq normanrecords.com/records/210372…
Telegraph sunset #telegraphpole #telegraphpoleappreciationsociety
Dark old brooding day today #telegraphpole #telegraphpoleappreciationsociety
One day I will get a really great photo of these rooftops. In the meantime, this one’s not bad.
Telegraphing #telegraphpoleappreciationsociety
Watch out looper kids, I’ve got a looper before AND after reverb. I am invincible!!! #looper #loser #butstillIprevail
We’re old, but we bring you pie x
There are THREE new Twilight Sequence albums coming, one on vinyl, two on CD, one accompanying a comic book by @zekeclough (which is AMAZING). There are two more albums in progress, one will feature tracks made with gong resonators which we’re very excited about.
Polypores 🌳👽�... @stephenjbuckley
4K Followers 2K Following Cosmically a shambles. Contact: [email protected] Other links below.
Kate Bosworth @KAAAATE22
4K Followers 4K Following Dark Train on @warminsterradio 105.5 FM. Moonday 2200. Season: FIGGY HOBBIN. Half of @BMH_13 🦹🏼♂️🦹🏻♀️🦜🦜☠️☠️ @IrregularPat1 & Dustopian Frequencies
Apta @AptaMusic
2K Followers 2K Following Chromatic cascades / Boss fight modular melodies. 'Wanton Gilmourisms'. @piccadillyrecs synth fancier.
Sulk Rooms @sulkrooms
4K Followers 1K Following Luminescent electronica. Yorkshire. Licensing @DominoPubCo. Playing in @pijnband. “Ephemeral, elusive and gloriously unsettling” - Electronic Sound Magazine
Concretism @concretism_mus
3K Followers 456 Following Music of a grim, Cold War Britain (2010-2025). Aside from the odd project, Concretism is now mothballed. https://t.co/GyrviydMYE
The Metamorph @TheMetamorphUK
1K Followers 333 Following Minimalist,futurist electronica with occasional forays into pastoral textures. https://t.co/pDTZZVEiAw
FieldLinesCartographe... @FLCartographer
3K Followers 1K Following “The sound of big, strange worlds” -Electronic Sound Magazine // Castles In Space / Quiet Details / Woodford Halse
DJ SpaceTerrapin @GehegeDrei
2K Followers 2K Following The Voice of the Zoological Garden. Archivist of Enclosure Three. It Came From Enclosure Three @madwaspradioMWR/@mixcloud. Gehege Drei Kaleidoskop: @mixcloud.
The British Stereo Co... @BritStereoColl
1K Followers 890 Following Retro electronica 1970s/1980s. The British Stereo Collective, The New Electric Frontier, The Eternal Machine, Ardala. Daylights as graphic artist.
CLAIR 🎵🍄🌈�... @ClairHotgem
5K Followers 5K Following Quietus 'Clair's tracks sift delicate layers into stunning intricate sound worlds' #Sähkö #HotGem #NTS #BBC3 #BBC6 MDANT DJ Sonic book club @listen_camp
Monochrome Echo @MonochromeEcho
994 Followers 2K Following electronic musician | producer | bassist | Moonkeeper Reckoning out now on Spun Out of Control https://t.co/KAnCZfYKrV
🇲 🇦 🇷 🇹 �... @martincarbrand
529 Followers 638 Following Music, Film, Art and Motorsport @martincarbrand.bsky.social
autumna. @avtvmna
1K Followers 497 Following *ambient_resistance. WFR | Shady Ridge | Neotantra | Shimmering Moods | Frosti | Preston Capes | Noci Miste | Fort Evil Fruit | Moolakii Club Audio Interface
soullessparty @soullessparty
3K Followers 3K Following Music/Comedy writer sort - As heard on ‘Scarred for Life’, BBC Radio 4 and 6, BBC Tees. Creator of ‘Listen Through the Brown Window’ 📻 (Apple/Spotify)
Kieran Mahon @KieranMahon1
2K Followers 2K Following UEFA C licensed coach. Maker of football programmes & electronic music. At the same time.
Bob Fischer @Bob_Fischer
10K Followers 4K Following Writer and that. Does @hauntedgen, co-founder of @mulgraveaudio. Also Wiffle Lever To Full!, Fortean Times, Electronic Sound, Doctor Who Magazine, Summer Winos
Jilk @jilkmusic
932 Followers 946 Following Post Rock Electronic collective | Live Sound | Mastering engineer income based rates - DM for rates.
Norman Records @normanrecords
49K Followers 15K Following UK vinyl specialists. The best music, the best service, the best prices.
Verona Lakin @VeronaLaki46392
76 Followers 2K Following
Kianna Blick @KiannaBlic61264
73 Followers 1K Following
Uhocoob @Uhocoob7586
37 Followers 2K Following
Ned Schulist @schulist30119
21 Followers 536 Following
WHI Recordings @WhiRecordings
841 Followers 899 Following Electronic music and sound. Releases by Secret Nuclear, tspear and more. Check the linktree for live dates and release info.
murmurs from the star... @AmbientFoxFire
198 Followers 573 Following The far out fox: music & trans life blogs I'm more active at https://t.co/D82LXRzqDT
Tonewulf @Tonewulf_Band
344 Followers 1K Following Tonewulf is an American electronic band from North Carolina. We explore reality through light and sound. Join us.
darby Jones @darbyjones123
2K Followers 6K Following NYC 📍media personality | content creator | marketing manager author | content writer @thesource
Dino Olivieri @OlivieriDino
89K Followers 74K Following Independent musician and producer. Crafting soundscapes, computer programs and visual wonders that defy the ordinary
Coney Island Sound @Cny_Islnd_Snd
1K Followers 2K Following Coastal Dwelling Music Maker. North Coast via Belfast, Hull, Gateshead & North Shields.
Meeru @meeru1414
2K Followers 3K Following
Multi Music @MultiMusic2k24
572 Followers 3K Following Meme coin monk 🧘 | Spirit: @Magallaneer | Scripture: #MAGAL
Mulgrave Audio @mulgraveaudio
490 Followers 411 Following Original audio drama. Where white noise meets dark forests, where waking terrors meet sleepy hollows, where analogue dreams meet digital nightmares...
Gareth Gardner @gardnergareth
1K Followers 1K Following Photographer, journalist and curator of architecture and design. Also runs Gareth Gardner Gallery in SE8, exhibiting photography of architecture and place.
🤍MIRADOR🖤 @_mirador_
92 Followers 147 Following MIRADOR: a turret, window, or balcony designed to command an extensive outlook. A view into another world, Witch-Folk from the North East of England
LinseyAxelrod @AxelrodLin29047
30 Followers 2K Following
Susan @s_berger13
187 Followers 3K Following
Anna @markland38anna
266 Followers 3K Following
Mobile Suits label @SuitsMobile
354 Followers 696 Following We are Dreampunk/Sci-fi digital, tapes and vinyls music https://t.co/Ij42y3qtwA instagram : https://t.co/ko0zeCSt8t
Ogle (Giulio Fontana) @Ogle_Music
138 Followers 338 Following Electronic musician from Rome. Blue glimpses of sound.
paul beard @15beardy
112 Followers 458 Following
Arthur @arthursdug
1K Followers 4K Following Musicrunningdugswalkingvegancyclinggymchesspoliticsmountainsbeercarslaurelnhardysnowboardingmorerunningthe smoutgardeningmorerunningradiopresenter
A'BEAR @janineabear
585 Followers 2K Following
Room of Wires @roomofwires
503 Followers 740 Following Room of Wires have never met. Together they create uneasy electronic music.
Mark Walters @MarkWalters_
9K Followers 5K Following Archaeologist @ The Trust for Welsh Archaeology - Sound & Music, Photography, Wildlife, Botany, Palaeontology, Astronomy, Art, LiDAR, Ancient History & Coinage
condorman @condorman72
75 Followers 553 Following
Ibiza party Techno ho... @Technohouse100
784 Followers 5K Following Techno house / Progressive trance # Productions
Pam @p_cook49
249 Followers 3K Following
Molly @w_molly38
254 Followers 3K Following
Trinidad @trinidad_wellma
359 Followers 3K Following
Tracy @tracyeaton32
266 Followers 3K Following
Evelyn @Evelyn71685959
263 Followers 3K Following
Alasdair O'May @AlasdairOMay
593 Followers 767 Following The modular half of @dohnavur_ and @Tayusmusic. Synth player for @numberstati0ns.
Pauline @a_pauline16
274 Followers 3K Following
Bonfirehill @onbonfirehill
480 Followers 1K Following Record label and artist collaboration - Rebecca Denniff and David Owen. seasonal almanac of electronica. https://t.co/gSgIgOTg6H monthly show #MDANT
montizhe @ebesorlecky
58 Followers 641 Following
Alice @alicejohn80
236 Followers 3K Following
Dominic Brunt @dominicbrunt
111K Followers 5K Following That Paddy off of Emmerdale Farm..oh you doo…the vet! Filmmaker, Archaeologist, Technical Sheet Metal Developer, Welder, Land Rover Enthusiast..really boring.
T. Foot @Foot339491T
12 Followers 51 Following
Hilary Robinson @hvrlon
186 Followers 450 Following Music maker: composer, piano, melodica, vox. Collaborates electro-acoustically with Jo Johnson @werkhouse: LP https://t.co/Qo1kiE5bMB. Solo @2ndlanguagerecs & @wiaiwya
Ernest Fasanya @ernest_fasanya
94 Followers 862 Following
Polypores 🌳👽�... @stephenjbuckley
4K Followers 2K Following Cosmically a shambles. Contact: [email protected] Other links below.
Kate Bosworth @KAAAATE22
4K Followers 4K Following Dark Train on @warminsterradio 105.5 FM. Moonday 2200. Season: FIGGY HOBBIN. Half of @BMH_13 🦹🏼♂️🦹🏻♀️🦜🦜☠️☠️ @IrregularPat1 & Dustopian Frequencies
Apta @AptaMusic
2K Followers 2K Following Chromatic cascades / Boss fight modular melodies. 'Wanton Gilmourisms'. @piccadillyrecs synth fancier.
Sulk Rooms @sulkrooms
4K Followers 1K Following Luminescent electronica. Yorkshire. Licensing @DominoPubCo. Playing in @pijnband. “Ephemeral, elusive and gloriously unsettling” - Electronic Sound Magazine
Concretism @concretism_mus
3K Followers 456 Following Music of a grim, Cold War Britain (2010-2025). Aside from the odd project, Concretism is now mothballed. https://t.co/GyrviydMYE
The Metamorph @TheMetamorphUK
1K Followers 333 Following Minimalist,futurist electronica with occasional forays into pastoral textures. https://t.co/pDTZZVEiAw
FieldLinesCartographe... @FLCartographer
3K Followers 1K Following “The sound of big, strange worlds” -Electronic Sound Magazine // Castles In Space / Quiet Details / Woodford Halse
DJ SpaceTerrapin @GehegeDrei
2K Followers 2K Following The Voice of the Zoological Garden. Archivist of Enclosure Three. It Came From Enclosure Three @madwaspradioMWR/@mixcloud. Gehege Drei Kaleidoskop: @mixcloud.
Woodford Halse @woodford_halse
2K Followers 879 Following I appreciate your support for the labels (WH, FC, PC) and for the music I make as Pulselovers.Find me on Insta, Blue Sky, Discord. Love yas, Mat x
The British Stereo Co... @BritStereoColl
1K Followers 890 Following Retro electronica 1970s/1980s. The British Stereo Collective, The New Electric Frontier, The Eternal Machine, Ardala. Daylights as graphic artist.
CLAIR 🎵🍄🌈�... @ClairHotgem
5K Followers 5K Following Quietus 'Clair's tracks sift delicate layers into stunning intricate sound worlds' #Sähkö #HotGem #NTS #BBC3 #BBC6 MDANT DJ Sonic book club @listen_camp
Monochrome Echo @MonochromeEcho
994 Followers 2K Following electronic musician | producer | bassist | Moonkeeper Reckoning out now on Spun Out of Control https://t.co/KAnCZfYKrV
Front & Follow / MORE... @frontandfollow
3K Followers 2K Following Currently MORE REALISTIC GOALS. A radio show. RENTAL YIELDS. YOU CAN NEVER LEAVE. Go gently x
Stephen Osborne @stephenjosborne
292 Followers 181 Following Photographer | Videographer | Editor | Animator 3D Artist | Graphic Designer. Collector of vinyl @OzzyLovesVinyl
autumna. @avtvmna
1K Followers 497 Following *ambient_resistance. WFR | Shady Ridge | Neotantra | Shimmering Moods | Frosti | Preston Capes | Noci Miste | Fort Evil Fruit | Moolakii Club Audio Interface
soullessparty @soullessparty
3K Followers 3K Following Music/Comedy writer sort - As heard on ‘Scarred for Life’, BBC Radio 4 and 6, BBC Tees. Creator of ‘Listen Through the Brown Window’ 📻 (Apple/Spotify)
Kieran Mahon @KieranMahon1
2K Followers 2K Following UEFA C licensed coach. Maker of football programmes & electronic music. At the same time.
Kayla Painter 💜�... @KaylaPainter
2K Followers 464 Following Producer | Lecturer | Connections to Sound on @resonanceextra | AMBIENT OWL CORE ⤵️ debut album ‘Fractures’ out now ⬇️
TelegraphPoleAppSoc @TPAS0001
116 Followers 17 Following We are the Telegraph Pole Appreciation Society.
Andertons Music Co. @andertonsmusic
37K Followers 784 Following The Award-Winning Family Music Store. Join our community of over a million musicians. #andertons | #guitar | #bass | #drums | #keys | #musictech
Plymouth Sound Wildli... @Sound_Wildlife
362 Followers 680 Following A small project to Identify and share the flora and fauna of Plymouth Sound!
Irish Wildlife Sounds... @SoundsIrish
10K Followers 324 Following Nature Boy book pre-order: https://t.co/KWMRES1JYR Wild Silence album: https://t.co/lAbGwTCKgo
Wildlife Sound @WildlifeSound
2K Followers 241 Following
julia holter @JULIA_HOLTER
129K Followers 455 Following new album "Something in the Room She Moves" out now https://t.co/l4gpkb1f4H
murmurs from the star... @AmbientFoxFire
198 Followers 573 Following The far out fox: music & trans life blogs I'm more active at https://t.co/D82LXRzqDT
Deb Grant @djdebgrant
14K Followers 1K Following DJ. Dubliner. Radio host @bbc6music. Columnist @bigissue. Co-host @whatgoespod.
Kozfest @officialKozfest
644 Followers 353 Following 3 days of psychedelic music and fun in mid Wales
The Secret DJ. @SecretDJBook
19K Followers 12K Following Jazzy sass from Ibiza. Management - [email protected]
Soil Association @SoilAssociation
105K Followers 5K Following Soil Association is the charity that digs deeper to transform the way we eat, farm & care for our natural world Twitter guidelines 👉https://t.co/9Q2Uokr9Bx
Jessica McCarty @jmccarty_geo
20K Followers 3K Following Personal account, don’t speak for employer not official NASA comms. I post🔥-food-climate- 🛰 science. ❤️s 🔁s not endorsements. She/her/Kentucky Hillbilly
Tonewulf @Tonewulf_Band
344 Followers 1K Following Tonewulf is an American electronic band from North Carolina. We explore reality through light and sound. Join us.
darby Jones @darbyjones123
2K Followers 6K Following NYC 📍media personality | content creator | marketing manager author | content writer @thesource
Border Community @bordercommunity
11K Followers 12K Following London-based record label. Worldwide distribution by PIAS UK. Holden & Zimpel press & radio by @9PR_music / live bookings by Naomi @Earth_Agency
Dino Olivieri @OlivieriDino
89K Followers 74K Following Independent musician and producer. Crafting soundscapes, computer programs and visual wonders that defy the ordinary
Coney Island Sound @Cny_Islnd_Snd
1K Followers 2K Following Coastal Dwelling Music Maker. North Coast via Belfast, Hull, Gateshead & North Shields.
R. dyer @being_and_tim
85 Followers 56 Following Erstwhile experimental musician, dungeon master, crossword lover, once made a philosophy comic called Being & Tim #actuallyautistic.
The Recordist @the_recordist
5K Followers 249 Following The ultimate in High Definition sound effects. My name is Frank, I am The Recordist. https://t.co/BQHdJlYEEi
Tonebenders Podcast @TheTonebenders
5K Followers 255 Following Award Winning Sound Design Podcast talking about the wide and varied world of audio post production for moving images.
Product London @Product_London
192K Followers 13K Following 🎶 Audio Mastering Studio 🎤 Music Production Blog 🔊 Record Label & Music Promotion 💻 Check out our website for more info.
Mulgrave Audio @mulgraveaudio
490 Followers 411 Following Original audio drama. Where white noise meets dark forests, where waking terrors meet sleepy hollows, where analogue dreams meet digital nightmares...
🤍MIRADOR🖤 @_mirador_
92 Followers 147 Following MIRADOR: a turret, window, or balcony designed to command an extensive outlook. A view into another world, Witch-Folk from the North East of England
Olly Wainwright @ollywainwright
43K Followers 1K Following Architecture and design critic of the @Guardian [email protected] Now: https://t.co/EVfZSXDbWa
Gareth Gardner @gardnergareth
1K Followers 1K Following Photographer, journalist and curator of architecture and design. Also runs Gareth Gardner Gallery in SE8, exhibiting photography of architecture and place.
Kilpatrick Audio @kilpatrickaudio
689 Followers 41 Following Kilpatrick Audio was founded by Andrew Kilpatrick to pursue the design of unique and high quality music and audio electronics.
Robin Rimbaud - Scann... @robinrimbaud
16K Followers 703 Following Global travelling explorer and flaneur electronique. Creative catalyst, magician and reasonably amusing raconteur. Oh, and I make musical things happen too.
Mobile Suits label @SuitsMobile
354 Followers 696 Following We are Dreampunk/Sci-fi digital, tapes and vinyls music https://t.co/Ij42y3qtwA instagram : https://t.co/ko0zeCSt8t
Matthew Shaw @apollolaan
1K Followers 2K Following Artist. Author of Atmosphere of Mona, co-founder of @the_stone_club 🌿🪨articles for @tweetbytheriver @Resurgence_mag @Permaculturemag #MDANT
Lally MacBeth @LallyMacBeth
1K Followers 671 Following writer /researcher / artist. Founder of @TheFolkArchive & co-founder of @the_stone_club #MDANT The Lost Folk out June 19 on Faber 🌿
Bedford Esquires @BedfordEsquires
5K Followers 1K Following Totally independent Grassroots Music Venue for 35 years, hosting the likes of Coldplay, Muse, Lizzo, Idles etc. #bedfordisntshit
Ogle (Giulio Fontana) @Ogle_Music
138 Followers 338 Following Electronic musician from Rome. Blue glimpses of sound.
Pure Life ЧЖ @PURELIFETAPES
3K Followers 824 Following ЧЖ // Hi-Tech-Lo-Fi-Sci-Fi // Arts Label est. 2018 // 📍 Todmorden, UK
Joe Banks @JoeBanksWriter
2K Followers 153 Following 'Hawkwind: Days Of The Underground', a MOJO, Uncut, Prog & Shindig book of the year. 'Rock And Role: The Visionary Songs Of Peter Hammill + VdGG' out 21/11/25.
A'BEAR @janineabear
585 Followers 2K Following
Mariam Rezaei @MariamRezaei
3K Followers 4K Following Dr+Tablist+Composer+Writer▪️#TurntableTrio #MariaChavez #VictoriaShen ▪️#TheSleepOfReasonProducesMonsters #MetteRasmussen #GabrieleMitelli #LukasKoenig
Gayle Brogan / Pefkin @featheredgothic
817 Followers 1K Following Pefkin - Burd Ellen - Electroscope - Meadowsilver - Greenshank Promoting gigs in Sheffield with Sonido Polifonico https://t.co/HGYie7godn
IKLECTIK @iklectikartlab
4K Followers 482 Following Established in 2014, IKLECTIK is a nonprofit creative organisation supporting experimental sound, art and technology.
Oram Awards @oram_awards
1K Followers 573 Following Celebrating innovation in sound, music and related technologies and elevating the work and voices of Women and Gender Diverse artists.
𝚕𝚘𝚞𝚕𝚊 ... @loulayorke
4K Followers 700 Following ✨live modular synths 🌊 🪩🫧 monthly mixtape | https://t.co/Wg1Qw76P9s | https://t.co/rvNtQIBBYi | mailing list https://t.co/eZeXX7qWLS
Mark Walters @MarkWalters_
9K Followers 5K Following Archaeologist @ The Trust for Welsh Archaeology - Sound & Music, Photography, Wildlife, Botany, Palaeontology, Astronomy, Art, LiDAR, Ancient History & Coinage
Room of Wires @roomofwires
503 Followers 740 Following Room of Wires have never met. Together they create uneasy electronic music.
condorman @condorman72
75 Followers 553 FollowingTrends for United States
16,5 B posts
30,2 B posts
26,1 B posts
9.384 posts
7.100 posts
3.578 posts
33,9 B posts
162 B posts
1.054 posts
2.146 posts
1.249 posts
22,4 B posts
1.875 posts
19,9 B posts
4.654 posts
6.656 posts
108 B posts
12,4 B posts
You might like
HAWKSMOOR 👁
@_Hawksmoor_
665 Followers
sm🥀
@smercatante_
861 Followers
🇲 🇦 🇷 🇹 �...
@martincarbrand
529 Followers
M J Saunders
@unitygains
3K Followers
Alan Leeson
@july1916
2K Followers
𝐃𝐉 𝐁𝐋𝐞...
@UrbanMutant_
747 Followers
Trevlad_Sounds
@Trevalicious
638 Followers
Nick Parnell
@headcornweather
2K Followers
Apta
@AptaMusic
2K Followers
Sam Sutcliffe
@FootSoldierSam
2K Followers